CABS-dock: EL-P

Project name: EL-P

Status: done

submitted: 2025-10-08 15:32:51, status changed: 2025-10-09 04:27:05

Project settings

Protein sequence(s)	PVNALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVTISWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAAGLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHEALLEYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEAMMDPVNALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVTISWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAAGLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHEALLEYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEAMMD input pdb
Peptide sequence	VKTENSWSNKAKSICQQQKPQRRPCSELLK
Simulation mc cycles	50
Peptide secondary structure	CCCCCCCCCCCCCCCCCCCCCCCCCHHHHH

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	37.1211	3.01715	15.6788	112
cluster_2.pdb ( medoid)	19.4824	5.54347	15.0409	108
cluster_3.pdb ( medoid)	16.9692	6.12876	15.1061	104
cluster_4.pdb ( medoid)	14.0939	7.6629	17.739	108
cluster_5.pdb ( medoid)	13.7714	9.07676	19.6778	125
cluster_6.pdb ( medoid)	13.3496	8.09014	16.9308	108
cluster_7.pdb ( medoid)	13.1957	7.35086	16.1129	97
cluster_8.pdb ( medoid)	10.4672	9.17154	21.5953	96
cluster_9.pdb ( medoid)	10.4209	7.00513	16.5787	73
cluster_10.pdb ( medoid)	9.04633	7.6274	18.0508	69