Project name: c53cc688e87cc2f

Status: done

submitted: 2026-01-22 13:26:00, status changed: 2026-01-22 20:37:45

Project settings
Protein sequence(s) VYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRPSQPLLPQHSSLETQLFCEEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSS input pdb
Peptide sequence AAREEVPGRRGYPGY
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 22.2307 8.18687 31.96 182
cluster_2.pdb ( medoid) 20.302 6.99438 26.7488 142
cluster_3.pdb ( medoid) 19.9246 8.8333 25.8235 176
cluster_4.pdb ( medoid) 13.6594 5.56393 20.0913 76
cluster_5.pdb ( medoid) 9.76914 11.1576 38.7974 109
cluster_6.pdb ( medoid) 9.73351 9.55462 33.4206 93
cluster_7.pdb ( medoid) 5.72524 13.9732 34.8741 80
cluster_8.pdb ( medoid) 5.72402 6.63869 20.3632 38
cluster_9.pdb ( medoid) 5.06673 7.10517 20.9724 36
cluster_10.pdb ( medoid) 4.42231 15.3766 31.245 68