CABS-dock: c5a1c5e0afba52d

Project name: c5a1c5e0afba52d

Status: done

submitted: 2026-01-11 16:17:47, status changed: 2026-01-11 19:40:20

Project settings

Protein sequence(s)	MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPADIHMEQSILRRVQLGHSNEMRLHGVMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence	RVIVQVGSNCFR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	24.8317	4.47009	25.6775	111
cluster_2.pdb ( medoid)	19.6495	6.87041	33.6427	135
cluster_3.pdb ( medoid)	18.1209	6.1807	42.6137	112
cluster_4.pdb ( medoid)	16.4609	9.29474	27.6616	153
cluster_5.pdb ( medoid)	14.7061	7.27589	25.1392	107
cluster_6.pdb ( medoid)	13.8013	8.69483	34.3366	120
cluster_7.pdb ( medoid)	12.0266	10.7262	33.7259	129
cluster_8.pdb ( medoid)	6.79758	7.06134	17.3356	48
cluster_9.pdb ( medoid)	3.84518	14.0436	30.86	54
cluster_10.pdb ( medoid)	2.17184	14.2736	33.0651	31