Project name: c61ff01db74ff66

Status: done

submitted: 2026-01-10 15:02:52, status changed: 2026-01-10 17:59:21

Project settings
Protein sequence(s) MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence LPPTDESIKYTIYNSTGIQIGAYNYMEIGG
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCEEEECCCCEEECCCCEECCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 34.562 2.98015 24.2062 103
cluster_2.pdb ( medoid) 22.6702 2.99953 16.5528 68
cluster_3.pdb ( medoid) 18.6258 5.63734 29.1526 105
cluster_4.pdb ( medoid) 17.308 7.91542 32.913 137
cluster_5.pdb ( medoid) 9.90055 15.7567 42.7437 156
cluster_6.pdb ( medoid) 9.26207 16.6269 38.4213 154
cluster_7.pdb ( medoid) 7.21488 12.6128 39.2598 91
cluster_8.pdb ( medoid) 4.9434 16.79 35.9891 83
cluster_9.pdb ( medoid) 4.88415 12.2846 29.0749 60
cluster_10.pdb ( medoid) 2.4649 17.4449 34.1937 43