Project name: c688fed41ddfad4

Status: done

submitted: 2024-07-26 05:05:27, status changed: 2024-07-26 06:54:43

Project settings
Protein sequence(s) ATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVV input pdb
Peptide sequence LQEEDAGEYGCMVDGAR
Simulation mc cycles50
Peptide secondary structure psipred CCHHHHHCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 23.35 6.42397 22.6568 150
cluster_2.pdb ( medoid) 20.5406 5.54999 23.3098 114
cluster_3.pdb ( medoid) 17.8915 6.87479 20.4424 123
cluster_4.pdb ( medoid) 12.4092 8.94496 23.9534 111
cluster_5.pdb ( medoid) 11.3795 5.97566 11.5152 68
cluster_6.pdb ( medoid) 10.5756 8.9829 22.3098 95
cluster_7.pdb ( medoid) 9.24244 13.741 30.4064 127
cluster_8.pdb ( medoid) 8.32235 13.3376 28.1996 111
cluster_9.pdb ( medoid) 7.79884 6.9241 12.0298 54
cluster_10.pdb ( medoid) 6.88749 6.82397 15.1937 47