CABS-dock: c7577e8a92fa0ea

Project name: c7577e8a92fa0ea

Status: done

submitted: 2026-04-03 14:21:57, status changed: 2026-04-03 19:25:07

Project settings

Protein sequence(s)	ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY input pdb
Peptide sequence	MQQNGYENPTYK
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	34.7425	3.62668	15.6847	126
cluster_2.pdb ( medoid)	26.1178	3.86709	19.3611	101
cluster_3.pdb ( medoid)	24.3864	4.55173	20.024	111
cluster_4.pdb ( medoid)	19.8103	7.16799	28.6648	142
cluster_5.pdb ( medoid)	14.5995	10.1374	23.4589	148
cluster_6.pdb ( medoid)	10.0223	10.9756	24.9329	110
cluster_7.pdb ( medoid)	9.07537	8.92525	24.2435	81
cluster_8.pdb ( medoid)	6.67637	10.4847	27.0495	70
cluster_9.pdb ( medoid)	6.58741	10.0191	24.6167	66
cluster_10.pdb ( medoid)	3.3156	13.5722	25.1359	45