CABS-dock: c77a3865813efac

Project name: c77a3865813efac

Status: done

submitted: 2026-01-21 15:02:50, status changed: 2026-01-21 17:28:34

Project settings

Protein sequence(s)	GTVFTTVEDLLGSKILLTCSLDDSTEVTGHRWLKGGVVLKEDALPGQKTEFKVDSSDDQWGEYSCVFLPEPMGTANIQLHG input pdb
Peptide sequence	VDPREGKTSSSFRAHESHKA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCHHCCCCHHCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	29.7208	4.10487	18.2062	122
cluster_2.pdb ( medoid)	25.6525	3.8203	18.273	98
cluster_3.pdb ( medoid)	17.0652	8.26245	16.5108	141
cluster_4.pdb ( medoid)	14.8696	10.6257	24.0938	158
cluster_5.pdb ( medoid)	13.6758	8.18965	23.7093	112
cluster_6.pdb ( medoid)	12.2717	5.29673	9.2185	65
cluster_7.pdb ( medoid)	11.3463	7.84394	13.8569	89
cluster_8.pdb ( medoid)	8.76756	12.8884	29.2244	113
cluster_9.pdb ( medoid)	5.83456	10.7977	24.9696	63
cluster_10.pdb ( medoid)	3.29993	11.8184	23.0486	39