CABS-dock: D4DN40

Project name: D4DN40_UPPS

Status: done

submitted: 2026-06-14 06:35:15, status changed: 2026-06-14 11:08:19

Project settings

Protein sequence(s)	KLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE input pdb
Peptide sequence	LPPL
Simulation mc cycles	50
Peptide secondary structure psipred	CCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	2545.05	0.039292	0.343834	100
cluster_2.pdb ( medoid)	55.9755	1.10763	3.31614	62
cluster_3.pdb ( medoid)	40.0175	2.94871	19.329	118
cluster_4.pdb ( medoid)	33.4397	3.73807	24.3429	125
cluster_5.pdb ( medoid)	31.2167	1.47357	4.08751	46
cluster_6.pdb ( medoid)	14.9694	11.1561	40.9641	167
cluster_7.pdb ( medoid)	13.2158	6.35602	20.1964	84
cluster_8.pdb ( medoid)	11.0221	9.52633	35.1298	105
cluster_9.pdb ( medoid)	6.67946	18.2649	44.1859	122
cluster_10.pdb ( medoid)	5.77657	12.291	32.6859	71