Project name: D4DN40_UPPS

Status: done

submitted: 2026-06-14 06:35:15, status changed: 2026-06-14 11:08:19

Project settings
Protein sequence(s) KLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE input pdb
Peptide sequence LPPL
Simulation mc cycles50
Peptide secondary structure psipred CCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 2545.05 0.039292 0.343834 100
cluster_2.pdb ( medoid) 55.9755 1.10763 3.31614 62
cluster_3.pdb ( medoid) 40.0175 2.94871 19.329 118
cluster_4.pdb ( medoid) 33.4397 3.73807 24.3429 125
cluster_5.pdb ( medoid) 31.2167 1.47357 4.08751 46
cluster_6.pdb ( medoid) 14.9694 11.1561 40.9641 167
cluster_7.pdb ( medoid) 13.2158 6.35602 20.1964 84
cluster_8.pdb ( medoid) 11.0221 9.52633 35.1298 105
cluster_9.pdb ( medoid) 6.67946 18.2649 44.1859 122
cluster_10.pdb ( medoid) 5.77657 12.291 32.6859 71