CABS-dock: c7d66cd60cc70b3

Project name: c7d66cd60cc70b3

Status: done

submitted: 2026-03-16 08:25:39, status changed: 2026-03-17 01:24:32

Project settings

Protein sequence(s)	VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence	RRRRGGVQVFGSNTYRRR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCEEECCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	13.593	9.34304	48.7304	127
cluster_2.pdb ( medoid)	12.8556	9.33447	30.8384	120
cluster_3.pdb ( medoid)	12.6189	11.0945	47.2004	140
cluster_4.pdb ( medoid)	9.01679	13.1976	38.6956	119
cluster_5.pdb ( medoid)	6.7313	14.856	29.1121	100
cluster_6.pdb ( medoid)	6.55747	17.5373	43.6126	115
cluster_7.pdb ( medoid)	5.0856	16.7139	38.7868	85
cluster_8.pdb ( medoid)	4.56568	15.1128	29.7519	69
cluster_9.pdb ( medoid)	4.54279	12.7675	31.3925	58
cluster_10.pdb ( medoid)	3.76987	17.7725	39.4941	67