CABS-dock: c7e30b022d8c380

Project name: c7e30b022d8c380

Status: done

submitted: 2026-04-14 06:20:29, status changed: 2026-04-14 15:24:53

Project settings

Protein sequence(s)	GSHHHHHHGSGTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMQVLANGVIDSDGNVIYTFTDYVNTKCDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDC input pdb
Peptide sequence	VVIPIELR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEECC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	49.7018	1.99188	11.1239	99
cluster_2.pdb ( medoid)	25.5431	4.38475	15.0814	112
cluster_3.pdb ( medoid)	21.6278	3.74518	10.7855	81
cluster_4.pdb ( medoid)	19.1306	3.76361	14.4362	72
cluster_5.pdb ( medoid)	18.9546	9.28536	44.776	176
cluster_6.pdb ( medoid)	17.1818	4.19049	10.417	72
cluster_7.pdb ( medoid)	15.7252	5.65972	14.0621	89
cluster_8.pdb ( medoid)	8.51961	11.7376	51.1296	100
cluster_9.pdb ( medoid)	8.21621	7.18092	14.2598	59
cluster_10.pdb ( medoid)	6.67831	8.83457	23.8356	59