Project name: TTP-4J8S

Status: done

submitted: 2026-01-12 17:42:11, status changed: 2026-01-12 23:45:16

Project settings
Protein sequence(s) QQTDLSQVWPEANQHFSKEIDDEANSYFQRIYNHPPHHPTMSVDEVLEMLQRFKDSTIKREREVFNCMLRNLFEEYRFFPQYPDKELHITACLFGGIIEKGLVTYMALGLALRYVLEALRKPFGSKMYYFGIAALDRFKNRLKDYPQYCQHLASSISHFMQFPHHLQQEYIEYGQQSRDPPVK input pdb
Peptide sequence AQPVAAPRRLPIFNRISVSE
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCCEECCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 25.6309 4.72086 15.4015 121
cluster_2.pdb ( medoid) 23.9471 1.46155 4.06338 35
cluster_3.pdb ( medoid) 18.5266 12.3066 41.6114 228
cluster_4.pdb ( medoid) 17.7638 8.7256 36.8822 155
cluster_5.pdb ( medoid) 14.0289 4.9184 12.9346 69
cluster_6.pdb ( medoid) 12.3967 7.01799 18.0762 87
cluster_7.pdb ( medoid) 12.3008 11.3814 38.3239 140
cluster_8.pdb ( medoid) 10.8042 2.40646 6.17993 26
cluster_9.pdb ( medoid) 9.51708 5.56893 13.9757 53
cluster_10.pdb ( medoid) 4.48494 19.1753 44.0898 86