Project name: c87be562b2bd6fc

Status: done

submitted: 2026-02-20 12:45:45, status changed: 2026-02-20 16:41:37

Project settings
Protein sequence(s) GGTMENLSRRLKVTGDLFDIMSGMSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYG input pdb
Peptide sequence CEGENSIPL
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 39.3489 3.43084 21.6576 135
cluster_2.pdb ( medoid) 35.0472 4.65087 19.8161 163
cluster_3.pdb ( medoid) 32.2356 4.49813 26.0458 145
cluster_4.pdb ( medoid) 30.4482 4.59797 21.4759 140
cluster_5.pdb ( medoid) 20.6167 3.92885 7.90832 81
cluster_6.pdb ( medoid) 20.3775 3.82776 14.5804 78
cluster_7.pdb ( medoid) 8.69478 6.78568 18.7558 59
cluster_8.pdb ( medoid) 7.25152 11.5838 29.7431 84
cluster_9.pdb ( medoid) 6.39935 14.2202 43.5248 91
cluster_10.pdb ( medoid) 1.39758 17.1725 35.0475 24