Project name: PD1-HP-h

Status: done

submitted: 2026-07-13 10:17:53, status changed: 2026-07-13 11:50:06

Project settings
Protein sequence(s) NPPTFSPALLVVTEGDNATFTCSFSNTSSFVLNWYRMSPSNQTDKLAAFPECRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKLQIKESLRAELRVTERRA input pdb
Peptide sequence HLWHWNKVKFTP
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 24.8765 4.58264 22.2795 114
cluster_2.pdb ( medoid) 23.6603 6.00161 19.591 142
cluster_3.pdb ( medoid) 19.0468 6.30026 21.8643 120
cluster_4.pdb ( medoid) 11.7788 8.57469 22.4987 101
cluster_5.pdb ( medoid) 11.1413 11.2195 25.0069 125
cluster_6.pdb ( medoid) 10.8547 12.8056 27.3016 139
cluster_7.pdb ( medoid) 10.0166 12.7788 25.5311 128
cluster_8.pdb ( medoid) 7.10674 8.30197 25.67 59
cluster_9.pdb ( medoid) 5.54519 9.01683 21.5268 50
cluster_10.pdb ( medoid) 3.69057 5.96114 13.4063 22