Project name: fibra6HUD_CADEMAUNICA

Status: done

submitted: 2025-12-05 18:50:24, status changed: 2025-12-05 21:06:33

Project settings
Protein sequence(s) NFMLTQPHSVSESPGKTLTISCTGSSASIASHYVQWYSIDSSSNSASLTISGLKTEDEADYYCQSYDGNNHWVFGGG input pdb
Peptide sequence MLTQPHS
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 19.0078 6.62887 24.6131 126
cluster_2.pdb ( medoid) 17.4981 6.45783 25.1301 113
cluster_3.pdb ( medoid) 12.8718 10.0219 37.3587 129
cluster_4.pdb ( medoid) 12.5821 12.637 30.3264 159
cluster_5.pdb ( medoid) 11.6902 8.29751 25.3653 97
cluster_6.pdb ( medoid) 7.08145 11.7208 26.7255 83
cluster_7.pdb ( medoid) 5.5905 13.7734 30.5469 77
cluster_8.pdb ( medoid) 5.41601 12.3707 27.2866 67
cluster_9.pdb ( medoid) 5.16907 15.0898 29.6324 78
cluster_10.pdb ( medoid) 4.84452 14.6557 32.0582 71