CABS-dock: c909c5d36b192a2

Project name: c909c5d36b192a2

Status: done

submitted: 2026-04-12 11:19:48, status changed: 2026-04-12 19:59:02

Project settings

Protein sequence(s)	VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence	RRRVQLFGSNDARRY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEECCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	25.2134	4.44209	36.5327	112
cluster_2.pdb ( medoid)	15.5094	7.5438	48.3474	117
cluster_3.pdb ( medoid)	15.4248	7.58518	35.2292	117
cluster_4.pdb ( medoid)	15.3701	7.93749	33.0297	122
cluster_5.pdb ( medoid)	12.9952	9.46506	30.2197	123
cluster_6.pdb ( medoid)	7.36711	12.4879	35.6589	92
cluster_7.pdb ( medoid)	6.73672	14.6956	39.7682	99
cluster_8.pdb ( medoid)	6.19655	15.0083	32.6387	93
cluster_9.pdb ( medoid)	5.05821	11.4665	25.7223	58
cluster_10.pdb ( medoid)	3.39715	19.7224	46.6612	67