Project name: HGRLRGSLAQGV

Status: done

submitted: 2026-04-02 10:04:03, status changed: 2026-04-02 10:32:43

Project settings
Protein sequence(s) MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVKLPA input pdb
Peptide sequence HGRLRGSLAQGV
Simulation mc cycles5
Peptide secondary structure psipred CCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 68.6926 1.47032 14.3839 101
cluster_2.pdb ( medoid) 24.7791 4.15673 20.7315 103
cluster_3.pdb ( medoid) 17.5147 8.62134 38.3503 151
cluster_4.pdb ( medoid) 15.0886 6.76008 32.1919 102
cluster_5.pdb ( medoid) 12.9792 7.93579 23.1086 103
cluster_6.pdb ( medoid) 10.1448 13.9973 29.691 142
cluster_7.pdb ( medoid) 8.54013 12.5291 26.8772 107
cluster_8.pdb ( medoid) 6.09522 14.1094 31.6607 86
cluster_9.pdb ( medoid) 2.85804 19.5939 39.2513 56
cluster_10.pdb ( medoid) 2.66776 12.7448 27.1528 34