CABS-dock: Akash

Project name: Akash

Status: done

submitted: 2026-06-12 06:35:52, status changed: 2026-06-12 10:42:41

Project settings

Protein sequence(s)	VPVYDTCTVPGSFALTFDDGPYGFSTRLDSTLNAANAKGSFFINGQNWGCIYDYADVLLERFNNGHFIASHTWSHVHMNQGTYEQLSHQLELVEQAMIRILGVKPLYMRPPYGEYNDVVLQVLRDRGYKGLIMWNQDSGDTFTPTPSSAQIIDSYRSFPEKTISLNHEIKDFTVDQVIPAVIPILQQKGFSLQTVPECLGLSSDPADWYVRVQEPGTRDDSWTCE input pdb
Peptide sequence	GPIQISHNYNYGPCGR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	28.952	7.42608	15.166	215
cluster_2.pdb ( medoid)	28.2269	3.82614	14.9472	108
cluster_3.pdb ( medoid)	25.8283	3.40712	14.3175	88
cluster_4.pdb ( medoid)	16.4716	6.3746	17.5436	105
cluster_5.pdb ( medoid)	15.1862	9.41647	19.9875	143
cluster_6.pdb ( medoid)	10.4952	8.86119	20.1968	93
cluster_7.pdb ( medoid)	9.95608	5.52426	14.7493	55
cluster_8.pdb ( medoid)	6.76474	13.7478	24.8967	93
cluster_9.pdb ( medoid)	6.38767	7.98413	24.9502	51
cluster_10.pdb ( medoid)	4.13245	11.8574	21.3967	49