CABS-dock: ca7f76081f441d0

Project name: ca7f76081f441d0

Status: done

submitted: 2026-07-09 04:54:40, status changed: 2026-07-09 08:57:56

Project settings

Protein sequence(s)	GSHMMLEADLELERAADVRRWEEQAEISSGSSSPPILSSISIKNEEEEQTLGLLEDGAYRIKQKGILGYSQIGAGVYYKEGTFHTMWHVTRRRGAVLMHKGKRIEPSWADVKKDLISYGGGGWKLEGEWKEGEEVQVLLALEPGKNPRAVQTKPGLFKTNTGTIGAVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVVVTRSGAYYVSAIAN input pdb
Peptide sequence	RRGSAGMVFS
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	26.9692	4.18996	23.9672	113
cluster_2.pdb ( medoid)	22.6924	2.95253	27.6385	67
cluster_3.pdb ( medoid)	19.3354	9.36108	43.0581	181
cluster_4.pdb ( medoid)	10.3476	12.0801	43.1835	125
cluster_5.pdb ( medoid)	9.95744	13.5577	36.3791	135
cluster_6.pdb ( medoid)	9.47148	14.1477	41.2416	134
cluster_7.pdb ( medoid)	6.81809	7.33343	34.7119	50
cluster_8.pdb ( medoid)	6.25137	13.1171	36.9604	82
cluster_9.pdb ( medoid)	6.19966	9.83925	35.4823	61
cluster_10.pdb ( medoid)	4.50383	11.5457	26.7181	52