Project name: ca7f76081f441d0

Status: done

submitted: 2026-07-09 04:54:40, status changed: 2026-07-09 08:57:56

Project settings
Protein sequence(s) GSHMMLEADLELERAADVRRWEEQAEISSGSSSPPILSSISIKNEEEEQTLGLLEDGAYRIKQKGILGYSQIGAGVYYKEGTFHTMWHVTRRRGAVLMHKGKRIEPSWADVKKDLISYGGGGWKLEGEWKEGEEVQVLLALEPGKNPRAVQTKPGLFKTNTGTIGAVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVVVTRSGAYYVSAIAN input pdb
Peptide sequence RRGSAGMVFS
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 26.9692 4.18996 23.9672 113
cluster_2.pdb ( medoid) 22.6924 2.95253 27.6385 67
cluster_3.pdb ( medoid) 19.3354 9.36108 43.0581 181
cluster_4.pdb ( medoid) 10.3476 12.0801 43.1835 125
cluster_5.pdb ( medoid) 9.95744 13.5577 36.3791 135
cluster_6.pdb ( medoid) 9.47148 14.1477 41.2416 134
cluster_7.pdb ( medoid) 6.81809 7.33343 34.7119 50
cluster_8.pdb ( medoid) 6.25137 13.1171 36.9604 82
cluster_9.pdb ( medoid) 6.19966 9.83925 35.4823 61
cluster_10.pdb ( medoid) 4.50383 11.5457 26.7181 52