CABS-dock: 1XQ8-IP-flex

Project name: 1XQ8-IP-flex

Status: done

submitted: 2026-07-27 07:23:44, status changed: 2026-07-27 09:30:32

Project settings

Protein sequence(s)

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA input pdb

Peptide sequence

TTDHISAAGPW

Simulation mc cycles

Peptide secondary structure psipred

CCCCCCCCCCC

Contact information

92:A 1:PEP

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	14.3957	8.96103	38.6878	129
cluster_2.pdb ( medoid)	10.7241	13.0547	44.1029	140
cluster_3.pdb ( medoid)	8.60955	10.9181	30.8096	94
cluster_4.pdb ( medoid)	6.93224	14.1368	38.4145	98
cluster_5.pdb ( medoid)	6.43184	14.1484	36.3463	91
cluster_6.pdb ( medoid)	6.22401	11.7288	27.6729	73
cluster_7.pdb ( medoid)	5.73614	14.9926	36.9691	86
cluster_8.pdb ( medoid)	5.38584	14.1111	32.3653	76
cluster_9.pdb ( medoid)	4.41384	13.367	25.0765	59
cluster_10.pdb ( medoid)	2.48321	18.5244	44.768	46