Project name: 1XQ8-IP-flex

Status: done

submitted: 2026-07-27 07:23:44, status changed: 2026-07-27 09:30:32

Project settings
Protein sequence(s) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA input pdb
Peptide sequence TTDHISAAGPW
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCC
Contact information
92:A 1:PEP
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 14.3957 8.96103 38.6878 129
cluster_2.pdb ( medoid) 10.7241 13.0547 44.1029 140
cluster_3.pdb ( medoid) 8.60955 10.9181 30.8096 94
cluster_4.pdb ( medoid) 6.93224 14.1368 38.4145 98
cluster_5.pdb ( medoid) 6.43184 14.1484 36.3463 91
cluster_6.pdb ( medoid) 6.22401 11.7288 27.6729 73
cluster_7.pdb ( medoid) 5.73614 14.9926 36.9691 86
cluster_8.pdb ( medoid) 5.38584 14.1111 32.3653 76
cluster_9.pdb ( medoid) 4.41384 13.367 25.0765 59
cluster_10.pdb ( medoid) 2.48321 18.5244 44.768 46