Project name: cb2c62c7b2832d4

Status: done

submitted: 2026-04-11 14:33:02, status changed: 2026-04-11 16:10:36

Project settings
Protein sequence(s) MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence RRRVQPYGSNDARRH
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 37.2123 3.11725 14.3628 116
cluster_2.pdb ( medoid) 23.7681 4.7122 20.4627 112
cluster_3.pdb ( medoid) 14.3724 7.37523 21.0275 106
cluster_4.pdb ( medoid) 13.2995 7.81984 26.3227 104
cluster_5.pdb ( medoid) 12.3359 11.43 29.8913 141
cluster_6.pdb ( medoid) 9.95344 13.7641 26.3479 137
cluster_7.pdb ( medoid) 9.56199 6.90233 15.0234 66
cluster_8.pdb ( medoid) 9.06395 8.27454 26.3733 75
cluster_9.pdb ( medoid) 7.50674 14.6535 32.3031 110
cluster_10.pdb ( medoid) 5.34723 6.17143 13.1106 33