Project name: cb99c59eb3405b

Status: done

submitted: 2026-06-24 03:42:50, status changed: 2026-06-24 06:05:11

Project settings
Protein sequence(s) GQGVGRGSVVGKTVVANSASDLEGVDLSESVIVTNSVDETLVPYIEQAVGLITEENGITSPSAIIGLEKSIPTIIGVENATKELKDGILVTVDAAQGKIFEGYANVL input pdb
Peptide sequence DTDNNDE
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 35.9677 3.92018 26.9678 141
cluster_2.pdb ( medoid) 24.9287 3.93121 12.4965 98
cluster_3.pdb ( medoid) 23.853 5.40811 21.262 129
cluster_4.pdb ( medoid) 21.7802 6.19829 15.3411 135
cluster_5.pdb ( medoid) 17.7287 7.16351 22.2256 127
cluster_6.pdb ( medoid) 17.2724 5.84749 17.5129 101
cluster_7.pdb ( medoid) 16.4238 7.79356 23.6541 128
cluster_8.pdb ( medoid) 12.7374 4.94605 13.8992 63
cluster_9.pdb ( medoid) 6.32024 9.80975 20.3666 62
cluster_10.pdb ( medoid) 0.932674 17.155 29.5752 16