CABS-dock: 8TBP_THYEND

Project name: 8TBP_THYEND_E2

Status: done

submitted: 2026-05-30 16:14:32, status changed: 2026-05-31 08:00:19

Project settings

Protein sequence(s)	DTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA input pdb
Peptide sequence	THYENDSTDLRDHIDYWKHMRL
Simulation mc cycles	200
Peptide secondary structure psipred	CCCCCCCCCHHHHHHHHHHCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	47.6347	2.26725	27.6743	108
cluster_2.pdb ( medoid)	24.6398	6.3718	15.8017	157
cluster_3.pdb ( medoid)	19.9977	6.0507	20.1068	121
cluster_4.pdb ( medoid)	18.7776	7.0829	16.1437	133
cluster_5.pdb ( medoid)	11.4225	11.5561	34.7792	132
cluster_6.pdb ( medoid)	11.053	7.41882	25.5474	82
cluster_7.pdb ( medoid)	8.09744	9.01519	35.8245	73
cluster_8.pdb ( medoid)	7.25214	12.9617	36.9359	94
cluster_9.pdb ( medoid)	4.71446	7.84819	27.7811	37
cluster_10.pdb ( medoid)	4.01674	15.6844	39.4553	63