CABS-dock: primed p20

Project name: primed p20

Status: done

submitted: 2025-05-09 14:45:35, status changed: 2025-05-09 19:47:40

Project settings

Protein sequence(s)	TPIATFVSGSPSLNTYNATTVNSSANAFSCAYYLQQWNIQGLLVTSLYLKLDSATMGNRPGDLNSANAKWFTFWVSAYLQQCNPSGIQAGTVSPSTATLTDFEPMANRSVTSPWTYSANGYYEPSIGEFQVFSPVVTGAWNPGNIGIRVLPVPVSASGERYTLLCYSLQCTNASIFNPNNSGTMIVGPVLYSCPAASLP input pdb
Peptide sequence	MQKRWK
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	30.7255	4.32865	21.8648	133
cluster_2.pdb ( medoid)	24.2701	5.60359	32.8665	136
cluster_3.pdb ( medoid)	23.4831	4.13064	26.5462	97
cluster_4.pdb ( medoid)	19.9015	11.4062	38.4479	227
cluster_5.pdb ( medoid)	14.4515	4.98219	19.1857	72
cluster_6.pdb ( medoid)	12.9584	7.94851	36.2998	103
cluster_7.pdb ( medoid)	11.455	8.9044	22.9203	102
cluster_8.pdb ( medoid)	6.13147	8.80703	20.7487	54
cluster_9.pdb ( medoid)	4.05966	8.37509	27.5003	34
cluster_10.pdb ( medoid)	3.32531	12.6304	32.1072	42