CABS-dock: YQSTDLCHQRNY

Project name: YQSTDLCHQRNY

Status: done

submitted: 2026-04-02 08:13:51, status changed: 2026-04-02 08:46:41

Project settings

Protein sequence(s)	MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVKLPA input pdb
Peptide sequence	YQSTDLCHQRNY
Simulation mc cycles	5
Peptide secondary structure psipred	CCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	24.0352	1.66422	2.88777	40
cluster_2.pdb ( medoid)	23.64	4.73774	23.6815	112
cluster_3.pdb ( medoid)	23.5975	6.78038	13.5449	160
cluster_4.pdb ( medoid)	17.7156	7.56397	32.1765	134
cluster_5.pdb ( medoid)	17.0663	10.7815	30.362	184
cluster_6.pdb ( medoid)	9.34577	7.49002	21.9975	70
cluster_7.pdb ( medoid)	8.2338	7.89429	17.0204	65
cluster_8.pdb ( medoid)	6.81886	12.9054	28.1892	88
cluster_9.pdb ( medoid)	5.73646	14.1202	35.5558	81
cluster_10.pdb ( medoid)	5.41566	12.1869	27.525	66