Project name: YQSTDLCHQRNY

Status: done

submitted: 2026-04-02 08:13:51, status changed: 2026-04-02 08:46:41

Project settings
Protein sequence(s) MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVKLPA input pdb
Peptide sequence YQSTDLCHQRNY
Simulation mc cycles5
Peptide secondary structure psipred CCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 24.0352 1.66422 2.88777 40
cluster_2.pdb ( medoid) 23.64 4.73774 23.6815 112
cluster_3.pdb ( medoid) 23.5975 6.78038 13.5449 160
cluster_4.pdb ( medoid) 17.7156 7.56397 32.1765 134
cluster_5.pdb ( medoid) 17.0663 10.7815 30.362 184
cluster_6.pdb ( medoid) 9.34577 7.49002 21.9975 70
cluster_7.pdb ( medoid) 8.2338 7.89429 17.0204 65
cluster_8.pdb ( medoid) 6.81886 12.9054 28.1892 88
cluster_9.pdb ( medoid) 5.73646 14.1202 35.5558 81
cluster_10.pdb ( medoid) 5.41566 12.1869 27.525 66