CABS-dock: cc1fb11a11624e3

Project name: cc1fb11a11624e3

Status: done

submitted: 2025-12-20 09:22:14, status changed: 2025-12-20 15:51:42

Project settings

Protein sequence(s)	MHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDS input pdb
Peptide sequence	AKRYSELNTVLTPTGWV
Simulation mc cycles	50
Peptide secondary structure psipred	CCCHHHHCCEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	27.171	5.44698	24.7755	148
cluster_2.pdb ( medoid)	25.137	5.76838	23.155	145
cluster_3.pdb ( medoid)	19.5876	5.76895	31.9295	113
cluster_4.pdb ( medoid)	17.5466	3.7614	8.50617	66
cluster_5.pdb ( medoid)	15.1866	5.46534	34.3644	83
cluster_6.pdb ( medoid)	13.7004	7.44502	34.4899	102
cluster_7.pdb ( medoid)	7.42972	17.0935	33.2828	127
cluster_8.pdb ( medoid)	7.40465	17.1514	33.4914	127
cluster_9.pdb ( medoid)	4.11057	7.29825	18.9024	30
cluster_10.pdb ( medoid)	3.97309	14.8499	29.209	59