CABS-dock: cc2727d21a7eaf5

Project name: cc2727d21a7eaf5

Status: done

submitted: 2026-04-01 14:28:57, status changed: 2026-04-01 15:13:54

Project settings

Protein sequence(s)	MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVKLPA input pdb
Peptide sequence	LVQMVSRLVSYV
Simulation mc cycles	5
Peptide secondary structure psipred	CHHHHHHHHHCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	93.0407	1.0748	2.7341	100
cluster_2.pdb ( medoid)	20.8579	9.58868	21.2097	200
cluster_3.pdb ( medoid)	19.7655	6.17237	36.7731	122
cluster_4.pdb ( medoid)	12.9354	6.02996	16.4785	78
cluster_5.pdb ( medoid)	8.75738	2.1696	6.67175	19
cluster_6.pdb ( medoid)	8.64222	11.8025	23.9892	102
cluster_7.pdb ( medoid)	7.59042	14.7554	37.1964	112
cluster_8.pdb ( medoid)	5.14976	18.2533	37.85	94
cluster_9.pdb ( medoid)	4.44657	6.0721	14.7134	27
cluster_10.pdb ( medoid)	4.29435	10.7118	25.5527	46