CABS-dock: cc5a7c45013c9be

Project name: cc5a7c45013c9be

Status: done

submitted: 2026-03-08 14:25:59, status changed: 2026-03-08 16:32:23

Project settings

Protein sequence(s)	MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence	VQLFGSNCW
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	70.2889	1.60765	14.0638	113
cluster_2.pdb ( medoid)	34.9042	3.09419	25.2588	108
cluster_3.pdb ( medoid)	22.3949	3.84015	14.6375	86
cluster_4.pdb ( medoid)	21.0318	9.22414	58.3199	194
cluster_5.pdb ( medoid)	16.7957	5.53714	32.9289	93
cluster_6.pdb ( medoid)	13.1759	5.76809	15.4075	76
cluster_7.pdb ( medoid)	12.8648	6.76265	22.3878	87
cluster_8.pdb ( medoid)	7.05679	14.3125	43.2439	101
cluster_9.pdb ( medoid)	4.92143	13.8171	57.3387	68
cluster_10.pdb ( medoid)	3.97599	18.6117	40.8274	74