Project name: cca404a6ad22b34

Status: done

submitted: 2026-03-13 11:32:29, status changed: 2026-03-13 14:42:27

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence RRRWKKVQLFGSNDA
Simulation mc cycles50
Peptide secondary structure psipred CCCCEEEEECCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 18.6066 7.95416 33.3387 148
cluster_2.pdb ( medoid) 16.4879 9.40081 30.2289 155
cluster_3.pdb ( medoid) 12.8733 11.3413 42.0578 146
cluster_4.pdb ( medoid) 12.2884 7.48671 27.7041 92
cluster_5.pdb ( medoid) 11.211 10.5254 34.859 118
cluster_6.pdb ( medoid) 10.1203 13.4383 31.0627 136
cluster_7.pdb ( medoid) 5.66062 12.3661 29.3968 70
cluster_8.pdb ( medoid) 4.46453 16.7991 35.5172 75
cluster_9.pdb ( medoid) 2.33867 15.3934 26.9002 36
cluster_10.pdb ( medoid) 1.50603 15.9359 26.2927 24