Project name: D3_m_m3_H20

Status: done

submitted: 2026-01-13 09:19:47, status changed: 2026-01-14 14:13:01

Project settings
Protein sequence(s) GTCVAYGDGHFITFDGDRYSFEGSCEYILAQDYCGDNTTHGTFRIVTENIPCGTTGTTCSKAIKLFVESYELILQEGTFKAVARGPGGDPPYKIRYMGIFLVIETHGMAVSWDRKTSVFIRLHQDYKGRVCGLCGNFDDNAINDFATRSRSVVGDALEFGNSWKLSPSCPDALAPKDPCTANPFRKSWAQKQCSILHGPTFAACRSQVDSTKYYEACVNDACACDSGGDAECFCTAVAAYAQACHDAGLCVSWRTPDTCPLFCDFYNPHGGAEWHYQPCGAPCLKTCRNPSGHCLVDLPGLEGCYPKCPPSQPFFNEDQMKCVAQCGCYDKDGNYYDVGARVPTAENCQSCNCTPSGIQCAHSLEACTCTYEDRTYSYQDVIYNTTDGLGACLIAICGSNGTIIRKAVACPG input pdb
Peptide sequence GDPPYKIRYMGIFLV
Simulation mc cycles100
Peptide secondary structure psipred CCCCCEEEEEEEEEC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 46.7682 2.24512 6.36131 105
cluster_2.pdb ( medoid) 45.5007 2.74721 8.6217 125
cluster_3.pdb ( medoid) 31.7704 3.36791 18.4111 107
cluster_4.pdb ( medoid) 23.5933 4.28088 26.3836 101
cluster_5.pdb ( medoid) 19.1019 4.71158 25.4316 90
cluster_6.pdb ( medoid) 17.5361 3.87771 7.01692 68
cluster_7.pdb ( medoid) 16.5204 3.5108 8.06996 58
cluster_8.pdb ( medoid) 10.5426 7.20888 15.9331 76
cluster_9.pdb ( medoid) 4.88121 7.78495 14.5152 38
cluster_10.pdb ( medoid) 4.41454 7.24877 19.644 32