Project name: cccdc36d3a50434

Status: done

submitted: 2025-11-12 10:39:45, status changed: 2025-11-12 14:43:02

Project settings
Protein sequence(s) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA input pdb
Peptide sequence KVFTAAVISGVGKYT
Simulation mc cycles50
Peptide secondary structure psipred CCEEEHHCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 29.3702 3.88149 25.2126 114
cluster_2.pdb ( medoid) 25.3336 9.4341 32.4875 239
cluster_3.pdb ( medoid) 19.2637 6.43699 28.5034 124
cluster_4.pdb ( medoid) 13.2356 10.0486 26.9896 133
cluster_5.pdb ( medoid) 10.9334 10.4268 23.5449 114
cluster_6.pdb ( medoid) 10.4706 11.1741 28.3428 117
cluster_7.pdb ( medoid) 8.48216 7.54525 22.7065 64
cluster_8.pdb ( medoid) 3.67973 13.3162 25.636 49
cluster_9.pdb ( medoid) 1.74835 12.5833 19.8222 22
cluster_10.pdb ( medoid) 1.6104 14.9032 26.1047 24