CABS-dock: Kibra WW1 Domain ile Peptit

Project name: Kibra WW1 Domain ile Peptit

Status: done

submitted: 2025-05-29 00:18:31, status changed: 2025-05-29 00:44:58

Project settings

Protein sequence(s)	LPLPEGWEEARDFDGKVYYIDHRNRTTSWIDPRD input pdb
Peptide sequence	YFHRIS
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	50.0516	2.49742	10.4953	125
cluster_2.pdb ( medoid)	31.9717	6.47447	26.4734	207
cluster_3.pdb ( medoid)	22.9252	5.23443	15.7738	120
cluster_4.pdb ( medoid)	19.0235	4.94126	12.9283	94
cluster_5.pdb ( medoid)	18.2663	4.48914	24.2276	82
cluster_6.pdb ( medoid)	15.3503	4.82075	20.1475	74
cluster_7.pdb ( medoid)	11.0919	9.91711	23.6445	110
cluster_8.pdb ( medoid)	10.6833	4.30581	13.0602	46
cluster_9.pdb ( medoid)	8.25686	8.23558	23.2146	68
cluster_10.pdb ( medoid)	7.33413	10.0898	31.603	74