CABS-dock: ce50f2e20d2eec7

Project name: ce50f2e20d2eec7

Status: done

submitted: 2025-12-13 22:58:54, status changed: 2025-12-14 02:45:59

Project settings

Protein sequence(s)	GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWFLNKDLEVDGHFVTMQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRD input pdb
Peptide sequence	YLYNTGRSV
Simulation mc cycles	10
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	35.1794	3.06998	24.8038	108
cluster_2.pdb ( medoid)	22.7916	4.43145	12.2204	101
cluster_3.pdb ( medoid)	18.4516	7.53321	35.7053	139
cluster_4.pdb ( medoid)	17.9773	5.84071	23.6825	105
cluster_5.pdb ( medoid)	10.877	14.8019	44.3352	161
cluster_6.pdb ( medoid)	10.1839	12.4706	41.1914	127
cluster_7.pdb ( medoid)	5.81807	12.3752	33.0265	72
cluster_8.pdb ( medoid)	4.87528	16.4093	45.8479	80
cluster_9.pdb ( medoid)	4.45736	13.2365	32.1805	59
cluster_10.pdb ( medoid)	2.40925	19.9232	39.4799	48