CABS-dock: HTG5hlj@

Project name: HTG5hlj@

Status: done

submitted: 2025-07-08 11:58:33, status changed: 2025-07-08 16:34:11

Project settings

Protein sequence(s)	DAYPVESEIINLTINGVARGNHFNFVNGTLQTRNYGKVYVAGQGTSDSELVKKKGDIILTSLLGDGDHTLNVNKAESKELELYARVYNNTKRDITVDSVSLSPGLNATGREFSANKFVLYFKPTVLKKNRINTLVFGATFDEDIDDTNRHYLLSMRFSPGNDLFKVGEK input pdb
Peptide sequence	HTGNHSLSHPQG
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	19.6572	9.10608	27.9146	179
cluster_2.pdb ( medoid)	19.3311	7.29396	24.6558	141
cluster_3.pdb ( medoid)	18.8724	9.6967	32.5223	183
cluster_4.pdb ( medoid)	11.3772	5.62528	20.3817	64
cluster_5.pdb ( medoid)	11.2493	6.57819	24.6385	74
cluster_6.pdb ( medoid)	10.5543	10.3275	25.4141	109
cluster_7.pdb ( medoid)	9.34741	9.3074	25.2233	87
cluster_8.pdb ( medoid)	7.97076	6.39838	17.7429	51
cluster_9.pdb ( medoid)	5.64695	12.3961	27.1432	70
cluster_10.pdb ( medoid)	2.98805	14.056	30.3192	42