CABS-dock: cf5f7671ca17efc

Project name: cf5f7671ca17efc

Status: done

submitted: 2026-04-01 11:52:32, status changed: 2026-04-02 03:16:54

Project settings

Protein sequence(s)	RTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLLFAESGQVYFGIIALRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLLFAESGQVYFGIIALRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLLFAESGQVYFGIIAL input pdb
Peptide sequence	MCMPCFTTDHQMARKCDDCCGGKGRGKCYG
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCHHHHHHCHHCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	31.8167	3.17443	27.3842	101
cluster_2.pdb ( medoid)	17.5065	6.79748	47.4728	119
cluster_3.pdb ( medoid)	14.5014	9.51633	47.5538	138
cluster_4.pdb ( medoid)	14.0306	7.41236	26.8586	104
cluster_5.pdb ( medoid)	10.8257	10.5305	52.4881	114
cluster_6.pdb ( medoid)	9.23453	15.9185	42.5455	147
cluster_7.pdb ( medoid)	6.51803	19.4844	50.8984	127
cluster_8.pdb ( medoid)	5.6354	13.6636	32.2522	77
cluster_9.pdb ( medoid)	3.64596	12.891	37.361	47
cluster_10.pdb ( medoid)	0.873323	24.0461	49.0065	21