Project name: pep12102

Status: done

submitted: 2026-02-14 07:03:23, status changed: 2026-02-14 17:56:45

Project settings
Protein sequence(s) GFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQ input pdb
Peptide sequence MNFGYFSWNP
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 62.6054 1.70912 19.7783 107
cluster_2.pdb ( medoid) 23.0223 6.99322 22.1095 161
cluster_3.pdb ( medoid) 21.1436 8.13486 21.7566 172
cluster_4.pdb ( medoid) 18.904 5.50147 28.7946 104
cluster_5.pdb ( medoid) 18.2457 6.90573 28.483 126
cluster_6.pdb ( medoid) 10.0132 10.586 25.0272 106
cluster_7.pdb ( medoid) 7.37951 12.1959 35.2965 90
cluster_8.pdb ( medoid) 4.88766 11.8666 26.0584 58
cluster_9.pdb ( medoid) 4.83657 11.3717 28.121 55
cluster_10.pdb ( medoid) 1.36753 15.3562 29.2951 21