CABS-dock: pep12102

Project name: pep12102

Status: done

submitted: 2026-02-14 07:03:23, status changed: 2026-02-14 17:56:45

Project settings

Protein sequence(s)	GFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQ input pdb
Peptide sequence	MNFGYFSWNP
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	62.6054	1.70912	19.7783	107
cluster_2.pdb ( medoid)	23.0223	6.99322	22.1095	161
cluster_3.pdb ( medoid)	21.1436	8.13486	21.7566	172
cluster_4.pdb ( medoid)	18.904	5.50147	28.7946	104
cluster_5.pdb ( medoid)	18.2457	6.90573	28.483	126
cluster_6.pdb ( medoid)	10.0132	10.586	25.0272	106
cluster_7.pdb ( medoid)	7.37951	12.1959	35.2965	90
cluster_8.pdb ( medoid)	4.88766	11.8666	26.0584	58
cluster_9.pdb ( medoid)	4.83657	11.3717	28.121	55
cluster_10.pdb ( medoid)	1.36753	15.3562	29.2951	21