CABS-dock: cfe9f99bc013de3

Project name: cfe9f99bc013de3

Status: done

submitted: 2025-12-15 20:09:04, status changed: 2025-12-15 23:43:05

Project settings

Protein sequence(s)	EVEDQITAVRKFIEMGFIDEKRIAIWGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNAQVDFQAMWYSDQNHGLSGLSTNHLYTHMTHFLKQCFS input pdb
Peptide sequence	GPIRPENPGED
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	47.1688	3.41327	8.69849	161
cluster_2.pdb ( medoid)	35.5868	3.42824	8.57955	122
cluster_3.pdb ( medoid)	30.8564	4.50474	16.2868	139
cluster_4.pdb ( medoid)	27.4786	4.51261	23.506	124
cluster_5.pdb ( medoid)	9.12486	10.0823	33.7745	92
cluster_6.pdb ( medoid)	8.97962	15.034	36.1088	135
cluster_7.pdb ( medoid)	7.7801	10.7968	31.7717	84
cluster_8.pdb ( medoid)	6.92947	5.77245	14.7319	40
cluster_9.pdb ( medoid)	4.60529	12.3771	29.2924	57
cluster_10.pdb ( medoid)	3.7566	12.2451	23.8061	46