Project name: d008d073fbeaf89

Status: done

submitted: 2025-11-13 02:14:39, status changed: 2025-11-13 05:29:07

Project settings
Protein sequence(s) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA input pdb
Peptide sequence TTDHISAAGPW
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 27.5383 4.28494 28.3493 118
cluster_2.pdb ( medoid) 16.2673 10.0816 44.0008 164
cluster_3.pdb ( medoid) 13.2576 8.97598 50.0818 119
cluster_4.pdb ( medoid) 11.1618 9.76543 27.715 109
cluster_5.pdb ( medoid) 8.10349 15.7957 48.8991 128
cluster_6.pdb ( medoid) 5.96793 19.7723 48.6024 118
cluster_7.pdb ( medoid) 4.89575 10.4172 26.617 51
cluster_8.pdb ( medoid) 4.39885 19.5506 52.4538 86
cluster_9.pdb ( medoid) 3.90204 11.7887 29.2405 46
cluster_10.pdb ( medoid) 3.51966 17.3312 39.7721 61