CABS-dock: d12584accc6f04e

Project name: d12584accc6f04e

Status: done

submitted: 2025-12-29 10:16:27, status changed: 2025-12-29 14:02:19

Project settings

Protein sequence(s)	MVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGATRRVIVFVQCGSNCRMVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGAT input pdb
Peptide sequence	NPVTGRPLVNIYNCSGVQVGDNNYLTMQQT
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCEEEEECCCCCEECCCCEEEEECC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	27.0466	5.02836	25.3708	136
cluster_2.pdb ( medoid)	14.3956	7.43281	23.8499	107
cluster_3.pdb ( medoid)	14.0953	7.87497	29.3007	111
cluster_4.pdb ( medoid)	12.5478	12.6715	32.063	159
cluster_5.pdb ( medoid)	10.2219	10.5656	28.9796	108
cluster_6.pdb ( medoid)	10.1701	7.27621	31.3697	74
cluster_7.pdb ( medoid)	8.36517	9.20484	20.5977	77
cluster_8.pdb ( medoid)	7.82067	13.0424	29.3217	102
cluster_9.pdb ( medoid)	6.81837	12.0263	30.0544	82
cluster_10.pdb ( medoid)	3.74537	11.7478	25.7262	44