CABS-dock: d16b5199a929c0b

Project name: d16b5199a929c0b

Status: done

submitted: 2025-12-31 16:39:15, status changed: 2025-12-31 19:05:29

Project settings

Protein sequence(s)	RLRGAVTRCEDGQLFITMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYC input pdb
Peptide sequence	GFYNEAVNYDTCK
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	39.662	2.8995	10.5513	115
cluster_2.pdb ( medoid)	28.3647	5.92285	18.8035	168
cluster_3.pdb ( medoid)	20.9265	5.25649	19.5712	110
cluster_4.pdb ( medoid)	18.2804	7.00203	29.259	128
cluster_5.pdb ( medoid)	15.4945	10.1327	28.1925	157
cluster_6.pdb ( medoid)	7.94626	8.3058	26.5488	66
cluster_7.pdb ( medoid)	7.21405	10.3964	31.9912	75
cluster_8.pdb ( medoid)	7.17121	8.36679	29.9333	60
cluster_9.pdb ( medoid)	6.97377	12.6187	29.156	88
cluster_10.pdb ( medoid)	3.21164	10.2751	30.3229	33