Project name: KR12 of Fnovocida acpP

Status: done

submitted: 2025-03-10 16:09:10, status changed: 2025-03-10 20:28:54

Project settings
Protein sequence(s) MSTHNEDSKKNNADEKAKIFSRVNHIIVEQLGVKEEDLKPEASFIDDLGADSLDTVELVMALEEEFDTEIPDEDAEKIRTVKDVYDYIESKDVG input pdb
Peptide sequence KRIVQRIKDFLR
Simulation mc cycles200
Peptide secondary structure psipred CHHHHHHHHHHC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 79.7218 2.09479 26.9175 167
cluster_2.pdb ( medoid) 65.4708 1.74123 12.8238 114
cluster_3.pdb ( medoid) 62.3936 2.06752 7.03656 129
cluster_4.pdb ( medoid) 42.9824 2.4196 9.42031 104
cluster_5.pdb ( medoid) 40.401 2.6732 11.3228 108
cluster_6.pdb ( medoid) 28.1365 2.20355 10.0736 62
cluster_7.pdb ( medoid) 25.4517 4.47908 16.7402 114
cluster_8.pdb ( medoid) 21.7209 5.98503 25.0213 130
cluster_9.pdb ( medoid) 3.69902 12.1654 25.0941 45
cluster_10.pdb ( medoid) 3.13252 8.61925 23.2704 27