Project name: 260628_LepB_3T_3

Status: done

submitted: 2026-06-28 04:14:17, status changed: 2026-06-28 09:17:12

Project settings
Protein sequence(s) RSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDGLRLSRIGGIH input pdb
Peptide sequence MLSFAADTTT
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 48.5183 3.48322 28.8869 169
cluster_2.pdb ( medoid) 40.4109 3.29119 24.6602 133
cluster_3.pdb ( medoid) 17.0311 5.75419 20.7653 98
cluster_4.pdb ( medoid) 15.3452 11.1436 44.9126 171
cluster_5.pdb ( medoid) 7.85701 12.6002 45.6575 99
cluster_6.pdb ( medoid) 6.83364 13.1701 40.7043 90
cluster_7.pdb ( medoid) 6.82769 13.7675 39.1122 94
cluster_8.pdb ( medoid) 3.97204 24.169 60.1824 96
cluster_9.pdb ( medoid) 3.94354 7.10023 23.9329 28
cluster_10.pdb ( medoid) 1.26316 17.4167 36.0854 22