CABS-dock: d20809a75cda2a1

Project name: d20809a75cda2a1

Status: done

submitted: 2026-06-13 08:02:10, status changed: 2026-06-13 10:50:14

Project settings

Protein sequence(s)	MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence	RRRVQPYGSNDARRHHHHHHHHHHH
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCHHHHCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	23.722	3.62532	22.455	86
cluster_2.pdb ( medoid)	15.282	8.31045	38.9947	127
cluster_3.pdb ( medoid)	14.7791	1.69158	8.34152	25
cluster_4.pdb ( medoid)	11.8265	10.5695	28.0536	125
cluster_5.pdb ( medoid)	11.8259	10.1472	29.1971	120
cluster_6.pdb ( medoid)	10.0178	11.5794	28.6027	116
cluster_7.pdb ( medoid)	9.12081	9.97718	32.0069	91
cluster_8.pdb ( medoid)	8.46438	13.5863	32.9308	115
cluster_9.pdb ( medoid)	6.78856	10.7534	23.3937	73
cluster_10.pdb ( medoid)	6.68858	18.24	38.1163	122