CABS-dock: d29ed8e7cd3bea

Project name: d29ed8e7cd3bea

Status: done

submitted: 2026-06-17 02:37:40, status changed: 2026-06-17 14:42:43

Project settings

Protein sequence(s)	YTPVEEKENGRMIVIVAKKYEGDIKDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENVIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLVNYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVACVNGDFLFSMPCFAEALMRAQKDGKPTGTVAIIASTIDQYWAPPMRGQDEMNEILCEKHPNNIKRTFGGVTMNGMFAMVEKYKKDGENMLDTWTVFGDPSLLVRTLVPTEMQVTAPANISASAQTFEVACDYNGAIATLSDDGDMVGTAIVKDGKAIIKLNESIADETNLTLTVVGYNKVTVIKDVKVE input pdb
Peptide sequence	RRRGGFLVRGK
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCEECCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	24.0091	5.33132	21.8054	128
cluster_2.pdb ( medoid)	19.2069	9.52783	32.4402	183
cluster_3.pdb ( medoid)	14.04	9.61538	48.3996	135
cluster_4.pdb ( medoid)	11.3442	10.3137	26.7974	117
cluster_5.pdb ( medoid)	11.2419	10.2296	46.5004	115
cluster_6.pdb ( medoid)	9.90655	9.38773	34.1595	93
cluster_7.pdb ( medoid)	5.95828	8.55951	37.0689	51
cluster_8.pdb ( medoid)	5.17192	14.8881	42.2227	77
cluster_9.pdb ( medoid)	4.94395	13.3497	33.2225	66
cluster_10.pdb ( medoid)	1.95738	17.881	48.4612	35