Project name: d29ed8e7cd3bea

Status: done

submitted: 2026-06-17 02:37:40, status changed: 2026-06-17 14:42:43

Project settings
Protein sequence(s) YTPVEEKENGRMIVIVAKKYEGDIKDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENVIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLVNYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVACVNGDFLFSMPCFAEALMRAQKDGKPTGTVAIIASTIDQYWAPPMRGQDEMNEILCEKHPNNIKRTFGGVTMNGMFAMVEKYKKDGENMLDTWTVFGDPSLLVRTLVPTEMQVTAPANISASAQTFEVACDYNGAIATLSDDGDMVGTAIVKDGKAIIKLNESIADETNLTLTVVGYNKVTVIKDVKVE input pdb
Peptide sequence RRRGGFLVRGK
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCEECCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 24.0091 5.33132 21.8054 128
cluster_2.pdb ( medoid) 19.2069 9.52783 32.4402 183
cluster_3.pdb ( medoid) 14.04 9.61538 48.3996 135
cluster_4.pdb ( medoid) 11.3442 10.3137 26.7974 117
cluster_5.pdb ( medoid) 11.2419 10.2296 46.5004 115
cluster_6.pdb ( medoid) 9.90655 9.38773 34.1595 93
cluster_7.pdb ( medoid) 5.95828 8.55951 37.0689 51
cluster_8.pdb ( medoid) 5.17192 14.8881 42.2227 77
cluster_9.pdb ( medoid) 4.94395 13.3497 33.2225 66
cluster_10.pdb ( medoid) 1.95738 17.881 48.4612 35