CABS-dock: d301d96d82a257f

Project name: d301d96d82a257f

Status: done

submitted: 2026-06-10 13:35:49, status changed: 2026-06-11 00:54:35

Project settings

Protein sequence(s)	KSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCRKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCRTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVI input pdb
Peptide sequence	AGAWEAFSSLSGSRVGSSGK
Simulation mc cycles	50
Peptide secondary structure psipred	CCHHHHHHHCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	30.7774	3.0217	17.7513	93
cluster_2.pdb ( medoid)	21.2964	5.02433	31.452	107
cluster_3.pdb ( medoid)	18.6287	5.42174	13.1528	101
cluster_4.pdb ( medoid)	18.3162	9.71819	34.1575	178
cluster_5.pdb ( medoid)	17.3871	4.42858	10.4445	77
cluster_6.pdb ( medoid)	16.2101	7.83461	30.336	127
cluster_7.pdb ( medoid)	13.5582	6.78557	31.1772	92
cluster_8.pdb ( medoid)	11.5269	9.62962	23.5257	111
cluster_9.pdb ( medoid)	7.71102	11.5419	29.9194	89
cluster_10.pdb ( medoid)	1.544	16.1917	36.4502	25