CABS-dock: d3304329b866dad

Project name: d3304329b866dad

Status: done

submitted: 2025-12-29 08:45:35, status changed: 2025-12-29 09:36:40

Project settings

Protein sequence(s)	AVCGPACGFVGAHYVPIAWAGVTAATGGFGKIRK input pdb
Peptide sequence	RLGAVILFV
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCEEEEC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	28.0317	4.67328	12.261	131
cluster_2.pdb ( medoid)	27.4581	6.84681	18.8096	188
cluster_3.pdb ( medoid)	27.0016	6.37	23.491	172
cluster_4.pdb ( medoid)	23.9339	5.76588	19.7413	138
cluster_5.pdb ( medoid)	22.0408	3.81112	12.4608	84
cluster_6.pdb ( medoid)	20.8326	3.07211	15.2219	64
cluster_7.pdb ( medoid)	16.3534	2.75171	10.0257	45
cluster_8.pdb ( medoid)	11.3672	6.94981	16.8727	79
cluster_9.pdb ( medoid)	7.56942	6.86975	17.4999	52
cluster_10.pdb ( medoid)	5.59441	8.40124	16.6268	47