CABS-dock: d3aff1f84985d97

Project name: d3aff1f84985d97

Status: done

submitted: 2026-01-21 11:02:41, status changed: 2026-01-21 16:18:44

Project settings

Protein sequence(s)	EASRQQQRRFNTSSIRDFEFWLSEAETLLAMKDQQARDLASSAGNLLKKHQLLERREMLAREDALKDLNTLAEDDLLSSSGTTFNVDQIVKKKDNNVNKRFLNVQELAAAHHEKLKEAYALFQFFQDLDDEESWIEEKLIRVSSQDYGRDLQGVQNLLKKHKRLEGELVAHEEPAIQNVLDMAEKLKDKAAVGQEEIQLRLAQFVEHWEEKLKELAKARGLKLEESLEYLQFMQ input pdb
Peptide sequence	RSLANDWQSSNLTGT
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCHHHHHCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	22.4792	12.9898	38.5599	292
cluster_2.pdb ( medoid)	19.2871	4.1997	20.6677	81
cluster_3.pdb ( medoid)	8.57432	8.9803	29.1786	77
cluster_4.pdb ( medoid)	8.56988	5.7177	20.3521	49
cluster_5.pdb ( medoid)	7.68595	7.67634	23.6739	59
cluster_6.pdb ( medoid)	5.48374	11.8532	28.3199	65
cluster_7.pdb ( medoid)	5.379	18.5908	39.3473	100
cluster_8.pdb ( medoid)	4.87044	13.5511	35.814	66
cluster_9.pdb ( medoid)	4.2025	14.5152	42.2811	61
cluster_10.pdb ( medoid)	3.37652	13.6235	39.0381	46