Project name: d3b677aff481a6f

Status: done

submitted: 2026-05-01 02:48:55, status changed: 2026-05-01 09:32:53

Project settings
Protein sequence(s) NLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGL input pdb
Peptide sequence VGAVAALR
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 38.2866 4.75362 53.4478 182
cluster_2.pdb ( medoid) 18.3831 6.52772 48.0691 120
cluster_3.pdb ( medoid) 17.7152 5.02392 12.2006 89
cluster_4.pdb ( medoid) 16.4594 8.68806 41.1766 143
cluster_5.pdb ( medoid) 15.8852 12.7792 50.5315 203
cluster_6.pdb ( medoid) 15.5293 4.50761 40.0561 70
cluster_7.pdb ( medoid) 10.247 4.68428 11.5477 48
cluster_8.pdb ( medoid) 6.67476 7.79054 38.7125 52
cluster_9.pdb ( medoid) 4.9224 7.11036 17.9588 35
cluster_10.pdb ( medoid) 3.58345 16.1855 46.4521 58