CABS-dock: d3c287f32e7927c

Project name: d3c287f32e7927c

Status: done

submitted: 2025-08-25 17:06:28, status changed: 2025-08-25 20:01:43

Project settings

Protein sequence(s)	SGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNSQVIGASVDSHFEHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVSPAGWKPGSDTIKP input pdb
Peptide sequence	NDIEYNRPSEIKNHGARQLY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCHHHHHCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	18.6701	6.58809	33.9943	123
cluster_2.pdb ( medoid)	12.5492	12.6701	37.7341	159
cluster_3.pdb ( medoid)	12.1058	10.1604	26.5462	123
cluster_4.pdb ( medoid)	11.9864	10.2616	24.7894	123
cluster_5.pdb ( medoid)	11.0331	8.06664	32.5873	89
cluster_6.pdb ( medoid)	9.55265	10.573	28.9922	101
cluster_7.pdb ( medoid)	8.01729	10.7268	27.9608	86
cluster_8.pdb ( medoid)	6.47745	12.3505	39.8435	80
cluster_9.pdb ( medoid)	5.19906	13.6563	32.5003	71
cluster_10.pdb ( medoid)	3.7503	11.999	23.6742	45