Project name: d3ef89163af6404

Status: done

submitted: 2026-03-15 11:16:06, status changed: 2026-03-15 15:49:50

Project settings
Protein sequence(s) QLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPETQDTTYLWWINNQSLPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANRSDPVTLNVT input pdb
Peptide sequence ETRLLAESF
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 33.5962 7.50086 27.4878 252
cluster_2.pdb ( medoid) 25.7431 5.78795 20.6842 149
cluster_3.pdb ( medoid) 17.5661 11.6133 32.5646 204
cluster_4.pdb ( medoid) 8.71694 11.5866 32.2799 101
cluster_5.pdb ( medoid) 6.66458 10.6533 32.2756 71
cluster_6.pdb ( medoid) 5.47352 12.2408 30.5246 67
cluster_7.pdb ( medoid) 5.31619 11.8506 31.6794 63
cluster_8.pdb ( medoid) 3.18169 12.2576 28.7478 39
cluster_9.pdb ( medoid) 2.65183 9.80456 21.6171 26
cluster_10.pdb ( medoid) 2.46811 11.3447 36.1584 28