Project name: DRAMP00856M

Status: done

submitted: 2024-07-25 15:24:43, status changed: 2024-07-26 00:18:14

Project settings
Protein sequence(s) SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMVLPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ input pdb
Peptide sequence GLPVCGETCVGGTCNTPGCTCSWPVCTRN
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCEECCCCCCCCCCEECCEEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 30.6214 3.42898 29.494 105
cluster_2.pdb ( medoid) 18.3261 6.49347 26.4859 119
cluster_3.pdb ( medoid) 16.0587 11.3957 27.1928 183
cluster_4.pdb ( medoid) 15.8139 7.39857 24.055 117
cluster_5.pdb ( medoid) 12.8121 7.10269 25.9324 91
cluster_6.pdb ( medoid) 12.8081 6.79257 27.8855 87
cluster_7.pdb ( medoid) 10.7432 5.95726 27.4948 64
cluster_8.pdb ( medoid) 10.2661 3.70149 5.72272 38
cluster_9.pdb ( medoid) 7.14414 6.85877 19.996 49
cluster_10.pdb ( medoid) 3.60168 13.0495 28.544 47